PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 990aa    MW: 109527 Da    PI: 6.3339
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41473.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.1e-29575626152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  KHN41473.1 575 AEKSISLDVLQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 626
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.37563646IPR003035RWP-RK domain
PfamPF020424.6E-25579626IPR003035RWP-RK domain
PROSITE profilePS5174524.955890972IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.1E-28890971No hitNo description
SMARTSM006669.4E-29890972IPR000270PB1 domain
SuperFamilySSF542779.48E-24890975No hitNo description
PfamPF005643.5E-20891971IPR000270PB1 domain
CDDcd064078.66E-37891971No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 990 aa     Download sequence    Send to blast
MSESKDENPD LPPKSKPQEE HGFAMDFDIS LESLWPSDHI SLVSNPMSPF LFSTISDQPC  60
SPVWAFSDAE DERLIRIAAS AGNTNTTTEN LVENYDNKKT VPPLVAIPTS ENPDAYCLIK  120
ERMTQALRHF KELTEQNVLA QVWAPMRNGN RYALTTSGQP FVLDPHSNGL HQYRTVSLMY  180
MFSVDGENDE IMGLPGRVFQ QKIPEWTPNV QFYSSKEYQR LNHAQHYNVR GTLALPVFEL  240
AGQSCVAVVE LIMTSQKINY APEVDKICKA LEAVKLRSSE ILEHQYIQIC NEDRQYALAE  300
ILEILTVVCE THSLPLAQTW VPCKHRSVLA HGGGHKKSCS SFDGCCMGQV CMSITEVAFY  360
VIDAHTWGFH EACVEHHLQQ GQGVAGRAFL SHNMCFCGNI AQFCKTEYPL VHYALMFGLT  420
SCFAVCLQSS HTGNDDYVLE FFLPPGITDF NEQKRLLGSI LATMKPHFQS LKIASGIELE  480
ENASIEIIEA RNERVNLRFE SIPITQSSKS PPRHASPNVG EGLPLEPSEQ KIMAYFDGIN  540
DGGSLGDNAG GHIDQNTSLK IKTKKKPSER KRGKAEKSIS LDVLQHYFTG SLKDAAKSLG  600
VCPTTMKRIC RQHGISRWPS RKIKKVNRSL SKLKCVIESV HGAERAFGLN SLSTVSLPIA  660
AGSFSEPSTS NKFNRQTSLT IRPSEPKINE KDFDASGASE TKRQAAMEDQ FLGLEARAQS  720
PEKVINDRGV ATQEIGTKGT NKFRTGSGSS ESSGNPTPHG SCHGSPPNEI SPPKDIFVTG  780
HSEKCLVLRG SLGSTTLHST STPNCTTAYP MPHIVETTEP QELFGGQLLE RAGSSKDLRN  840
LCPSADAVLE DQVPEAYKMN PQCSDLPQMQ HMDNLNNTLT PFAVRKEVKS VTIKATYKED  900
IIRFKVSMDC GIVELKEEIA KRLKLEAGTF DIKYLDDDHE WVLIACDADL QECMDISRSS  960
GSNVIRLVVH DILPILGSSC ESSGDWKGCI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533182.20.0PREDICTED: protein NLP6-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A0B2S9T70.0A0A0B2S9T7_GLYSO; Protein NLP7
TrEMBLK7LDR90.0K7LDR9_SOYBN; Uncharacterized protein
STRINGGLYMA09G25230.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]